SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061230 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061230
Domain Number 1 Region: 2027-2220,2271-2454,2488-2543
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.56e-111
Family DNA polymerase I 0.000000917
Further Details:      
 
Domain Number 2 Region: 284-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.58e-43
Family Tandem AAA-ATPase domain 0.00026
Further Details:      
 
Domain Number 3 Region: 661-828
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 3.4e-41
Family Achaeal helicase C-terminal domain 0.0015
Further Details:      
 
Domain Number 4 Region: 72-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-37
Family Tandem AAA-ATPase domain 0.00019
Further Details:      
 
Domain Number 5 Region: 1859-1988
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000683
Family DnaQ-like 3'-5' exonuclease 0.01
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000061230
Domain Number - Region: 517-616
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000517
Family RecQ helicase DNA-binding domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061230   Gene: ENSRNOG00000002471   Transcript: ENSRNOT00000063995
Sequence length 2547
Comment pep:known chromosome:Rnor_5.0:11:69681013:69786646:-1 gene:ENSRNOG00000002471 transcript:ENSRNOT00000063995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPRRSGKRRRSSSGSDSFSFSGDGDSCVSPQLLCRPVLSPPPGLGRGRRLAGTGTCKQ
RVSDDQIDQLLLANWGLPKAVLEKYHNFGVKKMFEWQAECLLLGQVLEGKNLVYSAPTSA
GKTLVAELLILKRVLETRKKALFILPFVSVAKEKKYYLQSLFQEVGIKVDGYMGSTSPTG
RFSSLDVAVCTIERANGLINRLIEENKMDLLGTVVVDELHMLGDSHRGYLLELLLTKVCF
VTRKSASCQADSASALACAVQIVGMSATLPNLQLVASWLNAELYHTDFRPVPLLESIKVG
NSIYDSSMKLVREFQPLLQVKGDEDHIVSLCYETVRDNHSVLVFCPSKKWCEKVADIIAR
EFYNLHHQPEGLVKSSEFPPVILDQKSLLEVIDQLKRSPSGLDSVLKNTVPWGVAFHHAG
LTFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPVFGGQPLDILTYKQMVG
RAGRKGVDTMGESILVCKNSEKSKGIALLQGSLEPVHSCLQSQGEVTSTMIRAILEIIVS
GVASTSQDMQTYAACTFLAADVKEGKQGIQRNRDDVQRGAVDACVTWLLENEFIQAAEPS
DGTGGKVYHPTHLGSATLSSSLSPTDTLDIFADLQRAMKGFVLENDLHIVYLVTPVFEDW
TSIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQMAIHKRFFT
SLVLLDLISEIPLKEINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLGWHNMELLLSQF
QKRLTFGIQRELCDLIRVSSLNAQRARFLYASGFLTVADLARADTVEVEAALKDALPFKS
ARKAVDEEEEAAEERRSMRTIWVAGKSLSAREAAALIVEEAKVILQQDLIEMGVQWGPHS
PLSSSTHSLTSGSEVKEHTFKSQTKSSHKRLASKSRNSMRVSGSNGKQSPEAGQGLDECR
ERPDSLCKFQGNHEIQTPSVYRARKRTSLGVNKEMLRTSLKEGKPSTKEVLQTLSFEKTR
KAALSFSSEQANNSFPSGRDRKYRKKSWGSSPMSDSVMHRDDLQGQTMCKSTLCEDPQKS
LEEQNTEYRSPGLFAKNVSFCAKEKCNKTSFPLQMQQPCLRRKPESGAAVDHSVAVSQNK
NVVEQPPGAPRDRRGLAAHGRAEVNEVLTENGTESQLHDTHPVSQCLENHSEKQTNTCTR
QKTLTEGQAGISHVTRGSNDLTPIRCERLKLNSKEHDSNPCPQALGTNAGRTEAPQSSEA
LGQAGGQCENLLNSPGIQEKTSAHATNKTEHSHVANQAFCDFGDSLYLDTQSEEIIEQMA
TKNATQGAEAAGITEEGSATQNEPHSTTGGQHIPGAANTDHVDRKNTESVKENPEKNIDR
RTPHSLIFHSPTPQGGNSACFKENEHSVTDSQLNSFLQGLETQDKPIIPLAPQMRTSTGV
EEESLPETSLNMSDSILFDSFGEDSFGQRQSLDVKAKQPLLSEMTPNHFHNPPYPQEDPV
MTPHMSEPQGTLERMACLSGESIIFSEIDSAQVIEALDNMAAFYMQENCNPITLKTEPRD
LAALGNECPQGEVVRGEQHEGSSKPKFMEINQDNSFTWSAASFNLSPELQRILDKVSTPR
ENEEPELMHADLSCFEENSTESHERQDMNSDLGTVQRTSFLPSNGVKSRTEGLESKAKHG
GASSALPHKAAADDNGLIPPTPLPASASASASKLALPEILGTSVKHQKASCLFDSPSDNQ
NQDLSQELRDSLKDSDGSVVDTSFFLQSQDGLLLTQASCSSESLAIIDVASDQILFQTFV
KEWQCQKRFSISLACEKMTSSTSSKTATIGGRLKQVNSPQEASVEDDGFPVHGSDCAVVV
GLAVCWGGKDAYYLSLQKEQKQSEMSPSLAPPPLDATLTVKERMEYLQSCLQKKSDQERS
VVTYDFIQTYKVLLLSCGISLEPSYEDPKVACWLLDPDSKEPTLHSIVTSFLPHELALLE
GIETGPGIQSLGLNVNTDHSGRYRASVESVLIFNSMNQLNSMLQKENLHDIFCKVEMPSQ
YCLALLELNGIGFSTAECETQKHIMQAKLDAIETQAYQLAGHSFSFTSADDIAQVLFLEL
KLPPNGEMKTQGGRKTLGSTRRGTESDRKLRLGRRFSTSKDILNKLKDLHPLPGLILEWR
RISNAITKVVFPLQREKHLNPFLRMERIYPVSQSHTATGRITFTEPNIQNVPRDFEIKMP
TLVRESPPSQASGKGQLAMARQNQKVYGLHPGQRTVLEKTSDRGVPFSVSMRHAFVPFPG
GLILAADYSQLELRILAHLSRDCRLIQVLNSGADVFRSIAAEWKMIEPDAVGDNLRQQAK
QICYGIIYGMGAKSLGEQMGIKENDAACYIDSFKSRYKGINHFMRDTVKNCRRDGFVETI
LGRRRYLPGIKDNNPYHKAHAERQAINTTVQGSAADIVKVATVNIQKQLETFHPTFKSHG
HRESMLQSDRAGLLPKRKVKGMFCPMRGGFFILQLHDELLYEVAEEDVVQVAQIVKNEME
CAIKLSVKLKVKVKIGASWGELKDFDV
Download sequence
Identical sequences D4A628
NP_001099348.1.100692 NP_001099348.1.4139 ENSRNOP00000060389 10116.ENSRNOP00000061230 ENSRNOP00000061230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]