SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061456 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061456
Domain Number 1 Region: 56-219
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000269
Family FKBP immunophilin/proline isomerase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061456   Gene: ENSRNOG00000024663   Transcript: ENSRNOT00000067076
Sequence length 733
Comment pep:known_by_projection chromosome:Rnor_5.0:5:82265619:82304918:-1 gene:ENSRNOG00000024663 transcript:ENSRNOT00000067076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKLASLFGLDQASVGHGNEFFQYTAPKQPKKGQGIAATGNQSAPKPAPATTGTSSVLFAT
AVHAYRCINGQYAKQGKFGAAVLGNHTTREYRILLYISQQQPVTVATIHLNFELMVRPNN
YSTFYDDQRQNWSIMFESEKAAVAFNKQVCVAKCNSISSLDAVLCQDLVAAEGPAVETGD
SLEVAYTGWLLQNHVLGQVFDSTANKDKPLRLKLGSGKVVKVKRPVLECSLNVETSLVCS
YLKSGNAHMLSFIHTDDVMVAESQLTAVKFARDSGSDGHSVSSRDSAAPSPIPAADSLSA
DPVVTPPLPLPLKPGEPALRSKSSSVSEPLTVSTSPDTAKAKLISRMAKMGQPMLPILPP
QLDSNDSETEDATLLRGAGPSLVTPSVQPSLQPSHPVLPQMASQAPQPAVSGLQTASAAL
MPAVSLDSHSAVSGNAQNFQPYAGVQAYTYPQTSSVSSQLQPARPLYPAPLSQAPHFQGS
GDMMSFLMTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSTGNSMLLPSMSVTMETS
MIMNNIQRIIQENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQ
TATENTQARILHAEQEKAKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTENLKETD
LLRGQVTRLQADLLELREASEQTQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKESLEK
VNSKAKFFLDSSA
Download sequence
Identical sequences ENSRNOP00000061456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]