SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061588 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061588
Domain Number 1 Region: 28-219
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000126
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061588   Gene: ENSRNOG00000018097   Transcript: ENSRNOT00000068168
Sequence length 993
Comment pep:known chromosome:Rnor_5.0:5:161560620:161585938:1 gene:ENSRNOG00000018097 transcript:ENSRNOT00000068168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVESWFCLCAVLLVPAAAVYEDQVGKFDWRQQYVGKLKFASLEFSPGSKKLVVATEK
NVIAALNSRTGEILWRHVDKGTAEGAVDAMLVHGQDAITVSNGGRIMRSWETNIGGLNWE
ITLDSGSFQALGLVGLQETVRYVAVLKKTTLTLHHLSSGHLKWVEHLPESDSILYQMVYS
YGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVWTPWLQHLTGACGVVDEAVLVCPDP
SSHSLHTLALETEWELRQIPLQSPDLEFGSGFQPQVLPTQPSPVAPSRAQFFLQLSPGHY
ALLHYHHGAVTLLKNFPQATLVSFATTGEKTVAAVMTCRTEVQKPGSAGDGSVASFPETS
GAQDSLACFNQTYTINLYLVETGRRLLDTSISFSLEQKGTRPEQLYVQVFLKKDDSVGYR
ALVQTQDHLQLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGL
LGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVT
ASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKETGMSS
LFVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLVDDEYKVTAFPATRNVLR
QLHELAPSIFFYLVDAEQGRLSGYRLRKDLTTELSWELIIPPEVQRVVQVKGKRSSEHVH
SQGRVMGDRSVLYKSLNPNLLAVVTESTDVHHERTFIGIFLIDGVTGRIIHSSVQKKARG
PVHLVHSENWVVYQYWNSKARRNELTALELYEGTEQYNATAFSSLDRPQLPQVLQQSYIF
PSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSP
DVQVHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDY
DYVLISSVLFGLVFATMITKRLAQVKLLNRAWR
Download sequence
Identical sequences D4A994
NP_001102160.1.100692 NP_001102160.1.4139 ENSRNOP00000061588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]