SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061983 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061983
Domain Number 1 Region: 338-593
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.24e-79
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 195-302
Classification Level Classification E-value
Superfamily Kringle-like 1.47e-34
Family Kringle modules 0.00066
Further Details:      
 
Domain Number 3 Region: 37-89
Classification Level Classification E-value
Superfamily Kringle-like 2.1e-19
Family Fibronectin type II module 0.0038
Further Details:      
 
Domain Number 4 Region: 95-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000141
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000061983
Domain Number - Region: 176-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.068
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061983   Gene: ENSRNOG00000015139   Transcript: ENSRNOT00000066586
Sequence length 595
Comment pep:known chromosome:Rnor_5.0:17:11845561:11853600:1 gene:ENSRNOG00000015139 transcript:ENSRNOT00000066586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALLFLGSLLMSLDLTLSAPPWKSKEFKDGAGDPSVVLTVDGKLCHFPFQYHRRLYHKC
IHKGQPGSRPWCATTPNFDEDQQWGYCLEPKKVKDHCSKHSPCHKGGTCVNTPNGPHCLC
PEHLTGKHCQREKCFESQLLKFFHENEIWFRTGPGGVARCQCKGPQAVCKLLTSQVCRVN
PCLNGGTCLLVEDHRLCHCPAGYAGPFCDLDLKATCYEDRGLSYRGQAKTTLSGAPCQRW
ASEATYRNMTETQALSWGLGHHAFCRNPDNDTRPWCYVWSGDRLSWDYCDLEQCQMPTLT
SPVSPESHDMLKPRPPILQSSPRDSTRNQNVVSRTSTVVCGQRFRKRLSSLRRVVGGLVA
LPGSHPYIAALYWGDSFCAGSLIDPCWVLTAAHCLQKRPAPEELTVVLGQDRHNQSCERC
QTLAVHSYRLHEGFSSKTYQHDLALLRLRGRKNSCAILSPHVQPVCLPSSAAPPSETVLC
EVAGWGHQFEGAEEYATFLQEAQVPFISLDRCSSSNVHGDAILPGMLCAGFLEGGADACQ
GDSGGPLVCDEGVTERQLTLRGVISWGSGCGDRNKPGVYTDVANYLDWIQEHTAF
Download sequence
Identical sequences D3ZTE0
ENSRNOP00000061983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]