SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062597 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062597
Domain Number 1 Region: 151-265
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.91e-28
Family Canonical RBD 0.00014
Further Details:      
 
Domain Number 2 Region: 63-150
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-25
Family Canonical RBD 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062597   Gene: ENSRNOG00000046272   Transcript: ENSRNOT00000065584
Sequence length 285
Comment pep:known chromosome:Rnor_5.0:10:36821959:36827505:-1 gene:ENSRNOG00000046272 transcript:ENSRNOT00000065584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSPGAAAPATPAGSGGGTTAAPSGNQNGA
EGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF
ILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFG
QFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVY
QQQQYGSGGRGNRNRGNRGSGGGQGSTNYGKSQRRGGHQNNYKPY
Download sequence
Identical sequences Q9QX80
ENSRNOP00000038183 ENSRNOP00000062597 NP_112620.2.100692 XP_008765954.1.100692 XP_017459540.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]