SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062823 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062823
Domain Number 1 Region: 37-246,280-513
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 5.82e-107
Family Arylsulfatase 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000062823
Domain Number - Region: 510-534
Classification Level Classification E-value
Superfamily dUTPase-like 0.0673
Family dUTPase-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062823   Gene: ENSRNOG00000047350   Transcript: ENSRNOT00000064349
Sequence length 544
Comment pep:known chromosome:Rnor_5.0:7:63691030:63722905:1 gene:ENSRNOG00000047350 transcript:ENSRNOT00000064349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPSAAGPGPGCPSRLPALLLLPLLSGCLGLVGAARRPNVLLLLTDDQDAELGGMTPLK
KTKALIGEKGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQE
PYTFPAILKLVCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSI
NGKARRHGENYSVDYLTDVLANLSLDFLDYKSNSEPFFMMISTPAPHSPWTAAPQYQKAF
PNVIAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIKFLDDAFRRRWQTLLSVDDLVEKLVK
RLDSTGELDNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKML
VSNIDLGPTILDLAGYDLNKTQMDGTSLLPILKGDGNLTWRSDVLVEYQGEGRNVTDPTC
PSLSPGVSQCFPDCVCEDAYNNTYACVRTLSSMWNLQYCEFDDQEVFVEVYNITADPDQI
TNIAKSIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDLRLMFSNHGSIRMRRFS
KHPL
Download sequence
Identical sequences Q32KJ5
10116.ENSRNOP00000006566 XP_003750373.1.100692 XP_006241458.1.100692 ENSRNOP00000062823 ENSRNOP00000006566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]