SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062857 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062857
Domain Number 1 Region: 348-478,518-881
Classification Level Classification E-value
Superfamily ALDH-like 8.17e-109
Family ALDH-like 0.00000198
Further Details:      
 
Domain Number 2 Region: 1001-1433
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.01e-85
Family L-arabinose binding protein-like 0.00014
Further Details:      
 
Domain Number 3 Region: 192-260
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000145
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062857   Gene: ENSRNOG00000042920   Transcript: ENSRNOT00000066203
Sequence length 1464
Comment pep:known chromosome:Rnor_5.0:5:161806691:161867202:1 gene:ENSRNOG00000042920 transcript:ENSRNOT00000066203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRWEEELAKCMNLQTMVDTLQEAAQEAEAIQEEMNEKIERLKAELVVFKGLMSDPMTDLD
TKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKDRKVASDDDISEQ
DGEVNRFSDEEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCN
PTIDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMC
SMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQDDLEREADVEPMTLLDV
QTGLSEVTSQAGTLRTSVMLPPALLRRSLLSYAWRGSGLRWKHASSLKVANEPILAFTQG
SPERDALQKALNDLKDQTEAIPCVVGDEEVWTSDVRYQLSPFNHGHKVAKFCYADKALLN
KAIEAAVLARKEWDLKPVADRAQIFLKAADMLSGPRRAEILAKTMVGQTLAEQLLRARSC
QRLGDVSQKQGRGVGKCIGYQTWLIMGKTVIQAEIDAAAELIDFFRFNAKFAVELEGEQP
ISVPPSTNHVVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAV
YRILREAGLPPNVIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRF
RTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPQSLWPQIK
GRLLEEHSRIKVGNPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESV
GYFVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDEKYRETLQLVDSTTSYGLTGAVFAQ
DKTIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASVKPGILYGCHFAVMGPQAR
TLCLLSLLLHVLPKPGKLVENSDFHLAGDYLLGGLFTLHANVKSISHLSYLQVPKCNDEV
TSSDGGAEQRVGGQDRVQSASGPLHGLCTKPQPRSSLLSPSEEVTVGVNGQWFTMKVLGY
NLMQAMRFAVEEINNCSSLLPGVLLGYEMVDVCYLSNNIHPGLYFLAQDDDLLPILKDYS
QYMPHVVAVIGPDNSESAITVSNILSHFLIPQITYSAISDKLRDKRHFPSMLRTVPSATH
HIEAMVQLMVHFQWNWIVVLVSDDDYGRENSHLLSQRLTKTSDICIAFQEVLPIPESSQV
MRSEEQRQLDNILDKLRRTSARVVVVFSPELSLYSFFHEVLRWNFTGFVWIASESWAIDP
VLHNLTELRHTGTFLGVTIQRVSIPGFSQFRVRRDKPGYPVPNTTNLRTTCNQDCDACLN
TTKSFNNILILSGERVVYSVYSAVYAVAHALHRLLGCNRVRCTKQKVYPWQLLREIWHVN
FTLLGNRLFFDQQGDMPMLLDIIQWQWDLSQNPFQSIASYSPTSKRLTYINNVSWYTPNN
TARTLAHGMVPPTSKVDLLSAKIF
Download sequence
Identical sequences ENSRNOP00000062857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]