SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064140 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064140
Domain Number 1 Region: 97-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000687
Family VPS37 C-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064140   Gene: ENSRNOG00000046439   Transcript: ENSRNOT00000074079
Sequence length 353
Comment pep:known chromosome:Rnor_5.0:1:233824905:233831155:1 gene:ENSRNOG00000046439 transcript:ENSRNOT00000074079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLKDKTLQELEEMQNDPEAIARLALESPEVQDLQLEREMALATNRSLAEQNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQIEGMKIEEESEAMAE
KFLEGEVPLETFLESFSSMRTLLHLRRVRVEKLQDVVRRPRALPELAGDAPPKRPPPPRP
APQAAPPETEEQTPQPSVVTPYPLPYSPSPGLPVGPTAQGALQPAPFPVVTQPSSYGGPL
GPSYPSPQPGPRAMVGYSWSPQRSGPPRPGYPVAPTSTSGPGYPLVGGQTPGPGYPQQSP
YFPSGSKPPYPTQPQLPGFPGQPPPPVPPQPPYPSGVTPPYGFHPPGSAWPRY
Download sequence
Identical sequences B5DFF4
10116.ENSRNOP00000001982 NP_001100933.1.100692 XP_003749107.1.100692 XP_006231095.1.100692 XP_006231096.1.100692 XP_006231097.1.100692 XP_006231140.1.100692 XP_006231141.1.100692 XP_017459892.1.4139 XP_017459893.1.4139 XP_017459894.1.4139 ENSRNOP00000001982 ENSRNOP00000064140 ENSRNOP00000001982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]