SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064166 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064166
Domain Number 1 Region: 215-642,675-751
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.86e-196
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 6-214
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 5.23e-71
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064166   Gene: ENSRNOG00000045752   Transcript: ENSRNOT00000074058
Sequence length 792
Comment pep:known chromosome:Rnor_5.0:1:173726994:173751294:1 gene:ENSRNOG00000045752 transcript:ENSRNOT00000074058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGRHSPMVASST
LEIVMAHKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYESYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTPEHTYDFEKLAEVTKVIVRNLNKI
IDINYYPIPEAHLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGAL
EASCDLAKEYGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQII
ACNGSIQSIPEIPEDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKALKEEEEKERNTAAMVCS
LENREECLMCGS
Download sequence
Identical sequences Q5U2Q5
ENSRNOP00000064166 NP_001013254.1.100692 NP_001013254.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]