SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064290 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064290
Domain Number 1 Region: 103-224
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000144
Family PX domain 0.0043
Further Details:      
 
Domain Number 2 Region: 304-358
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000236
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 896-926
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000488
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064290   Gene: ENSRNOG00000018226   Transcript: ENSRNOT00000074448
Sequence length 950
Comment pep:novel chromosome:Rnor_5.0:19:64385449:64425619:-1 gene:ENSRNOG00000018226 transcript:ENSRNOT00000074448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLNGGGGGGGGGGGGGKSAPGPSGALPTCSACHKM
APRTETPVSSISNSLENALHTSAHSTEEALPKRPLGKHGKVSVEKIDLKGLSHTKSDRGV
ECSFEVLWSDSSVTSVTKSSSEVTEFISKLSQLCPEENLDKLIPCLAGPDSFYVERNHVD
LEAGLRFLASIPAHTLKHDHVRKFFSASSPSQQLQSPSPGNPSPPKVGAMMGVSGRPVCG
VAGIPSSQSSTQHHLQHSASSSASLPHCSHTGGAGPALAYRTQVDNSPTILMPSGLQAPQ
PQEQNGILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELE
KEKSERRCLNSSAPSLVTSSGVARVTPTSHVGPVQPGRSSHASELRVEVEPPAHQLPREG
SSSEYSSSSSSPMGVQAREESSDSAEESDRRVDIHVEGTEKEKPVMLLAHFPSSSARPTA
QVLPVQNETGSSPAGHHPLPAQLMPAAPHLAPVRMLNSVHKSDRGSTDVKLLSSSVHSLL
SLEERGKGPAPRSGTKVDKSFGGAVLDTLPSAAPHPPVQGLSGLVENTSVSPNVSFGPRA
KVVHAATLDRVLKTAQQPALTVETSSAATGTPSTVLHVARPPIKLLLSSSVPADTAISGQ
TSCPNNGQISVPPAILNPRNALYTANTKVAFSAVSSVPVGPLQGSFCANSNTASPSSHPS
TSFASMATLPSCPAPSSSPALSSVPESSFYSGGAGSSSPGNIPASSQSHHHHHHHQQPPA
PPPPGCIVCTSCGCSGSCGSNGLTVSYANYFQHPFSGPSMFTFPFLPFSPMCGNGYVSTQ
QYGGGSAFPVVHTAYNGSVTPDPVLGGQSTFAVPPMQHFMTGTAGVHQAQGLVGSSNGSS
HKKSGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences 10116.ENSRNOP00000055284 ENSRNOP00000055284 XP_001079169.3.4139 ENSRNOP00000064290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]