SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064415 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000064415
Domain Number - Region: 77-116
Classification Level Classification E-value
Superfamily LysM domain 0.00379
Family LysM domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064415   Gene: ENSRNOG00000050624   Transcript: ENSRNOT00000075131
Sequence length 293
Comment pep:novel chromosome:Rnor_5.0:1:129266339:129269152:1 gene:ENSRNOG00000050624 transcript:ENSRNOT00000075131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQKEVLAKTFQGPAVVCRTPNSHVYMFKNGSGDSGDSSEEESHQVVLRPRGKERQKNSS
QPPGTGTMVLLQRELAQEDSLNKLALQYGCKVADIKKANNFIREQDLYALKSIKIPVRNH
GILTETHQELMPLGASSSETRVTLVELPEDGDASGATAQGNQLTEFFKGIDENIERAVQS
DVFHSDGCCVEAPDQPLLPITQKPAADGADCGIQWWNAVFLMLLIGIVLPVFYLVYFKIQ
ATGETSDSLNTTVVPNGSMTLSPVPGQAPRLAVAVPTLPASDNQVSPTTEAGA
Download sequence
Identical sequences ENSRNOP00000064415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]