SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064722 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064722
Domain Number 1 Region: 387-501,621-767
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.04e-63
Family Phosphate binding protein-like 0.00000000208
Further Details:      
 
Domain Number 2 Region: 20-364
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.65e-34
Family L-arabinose binding protein-like 0.018
Further Details:      
 
Domain Number 3 Region: 517-620
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000275
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064722   Gene: ENSRNOG00000045816   Transcript: ENSRNOT00000071615
Sequence length 887
Comment pep:known chromosome:Rnor_5.0:10:42257921:42571220:1 gene:ENSRNOG00000045816 transcript:ENSRNOT00000071615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPIISDSQ
HLQWGRGGVREKSQGLEVYSINVRNRVLNQDTCITHHRCLVRMLPVCSGQRSHLVDTVFV
TVAVCVTDEYPPILQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTD
TIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNA
GDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIG
YWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCV
ELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVRE
EVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRF
SPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWW
FFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAV
FEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGN
LDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSA
LSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLP
RNSGAGASGGGGSGENGRVVSQDFPKSMQSIPCMSHSSGMPLGATGL
Download sequence
Identical sequences ENSRNOP00000064722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]