SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065201 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065201
Domain Number 1 Region: 5-394
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 8.01e-139
Family Phosphoglycerate kinase 0.00000000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065201   Gene: ENSRNOG00000026928   Transcript: ENSRNOT00000036860
Sequence length 395
Comment pep:novel chromosome:Rnor_5.0:2:61775511:61776728:1 gene:ENSRNOG00000026928 transcript:ENSRNOT00000036860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKQIVMRVDFSVPMKNNQITNNQRIKAAVPSIKFCHPGRPDGVPM
PDKYSLEPVAAELKSLLGKDVLFLKDCVGSEVENACANPAARTVILLENLHFHVEEEGKG
KDASGNKVKAEPAKIDAFQASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKK
ELSYFTKALESPERPFLAILGGAKVEDKIQLINNMLDKVNEMIIGGGIASTFLKVLNNME
IGTSLCDEEGAKIVKELMVKAEKNGVKITLPVDFVTADKFDENAKTGQATVASGIPAGWL
GLDCGTEGSEKYAETVARAKQIGEAFARGTKSLVDEVVTAASRGCITIIGGGNTATCCAK
WNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNV
Download sequence
Identical sequences M0R6Y8
ENSRNOP00000065201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]