SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065246 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065246
Domain Number 1 Region: 127-166
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000186
Family Retrovirus zinc finger-like domains 0.0012
Further Details:      
 
Domain Number 2 Region: 86-127
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000523
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 3 Region: 38-83
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000454
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 4 Region: 2-24
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000151
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065246   Gene: ENSRNOG00000002923   Transcript: ENSRNOT00000003899
Sequence length 170
Comment pep:novel chromosome:Rnor_5.0:X:75298571:75299083:1 gene:ENSRNOG00000002923 transcript:ENSRNOT00000003899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKSCFKCGRSGHWARECPKGGTRGRTTRGRTRGPQCSSASQSDVCYRCGETGHYAKDC
DLLQDTCYNCGRRGHIAKDCTQAKREREQCCYICSRPGHLARDCDRQEEQKCYTCGEFGH
IQKDCTQIKCYRCGENGHMAVNCSKASEVSCYRCGESGHLARECPIEATA
Download sequence
Identical sequences M0R729
XP_003752133.1.100692 XP_003754844.1.4139 ENSRNOP00000065246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]