SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065369 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065369
Domain Number 1 Region: 30-185
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.84e-33
Family UbiE/COQ5-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065369   Gene: ENSRNOG00000046700   Transcript: ENSRNOT00000074851
Sequence length 253
Comment pep:known chromosome:Rnor_5.0:12:26767621:26776161:-1 gene:ENSRNOG00000046700 transcript:ENSRNOT00000074851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEEAGRLPQVLARVGTSHGITDLACKLRFYDDWAPEYDQDVAALKYRAPRLAVDCLSQ
ALQGPPHDALILDVACGTGLVAVELQARGFLQVQGVDGSPEMLKQARARGLYHHLSLCTL
GQEPLPYPKGTFDAVIIVGALSEGQVPCSAIPELLRVTKPGGLVCLTTRTNPSNLPYKEA
LEAALDSLEQAGAWERLVTQPVDHWELATSEQESGLATCANDGFISGVIYLYRKQETAQG
ERGRLSIQPLIDH
Download sequence
Identical sequences D4AED6
NP_001102969.1.100692 NP_001102969.1.4139 RnR236 10116.ENSRNOP00000002002 ENSRNOP00000065369 ENSRNOP00000036661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]