SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065665 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065665
Domain Number 1 Region: 209-346
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-34
Family C-type lectin domain 0.00059
Further Details:      
 
Domain Number 2 Region: 354-489
Classification Level Classification E-value
Superfamily C-type lectin-like 1.33e-33
Family C-type lectin domain 0.00073
Further Details:      
 
Domain Number 3 Region: 636-792
Classification Level Classification E-value
Superfamily C-type lectin-like 7.25e-27
Family C-type lectin domain 0.00092
Further Details:      
 
Domain Number 4 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.45e-27
Family Cysteine rich domain 0.006
Further Details:      
 
Domain Number 5 Region: 501-627
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-19
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 6 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-16
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 7 Region: 801-865
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000186
Family C-type lectin domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065665   Gene: ENSRNOG00000007012   Transcript: ENSRNOT00000071468
Sequence length 867
Comment pep:novel chromosome:Rnor_5.0:3:51512186:51565223:-1 gene:ENSRNOG00000007012 transcript:ENSRNOT00000071468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRWATPGRATGLLVLLLRCFELVEPSVNPGNNPFTIVNENTGKCLQPLSDWIVAQDCS
ETKNMLWKWVSQHRLFHLESQKCLGLDITKATDNLRMFNCDSKAMLWWKCEHHSLYTAAQ
YSLALKDGYATASTNSTDVWKKGGSKENLCDQPYHEIYTRDGNSYGRPCEFPFLIGKTWH
HDCIRDEDHKGPWCATTLNYEYDQKWGICLQPENGCEGNWEKNGQIGSCYQFNNQEVLTW
KEAYVSCQNQGADLLSIHSTAELAYITGKEDIARIVWIGLNQLYSARGWEWSDFKPLKFL
NWDPGMPIAPVIGGSSCARMDTESGLWQSVSCESQQPYICKKPLNSTAERPDDWTDSDTL
CDGGWLPNKGFCYLLANESGSWDAARMKCKALGADLTSIHSLADVELVVTKLHSGDVKEE
IWTGLKNTNSPTLFQWSDGTEVTVTHWNENEPNVPYNKTPNCVSYLGKLGQWKVQSCEKE
LRYVCKKKGEITKDARSDELCPPNEGWKRHGETCYKIYEKEVPFGTNCNLTITSRFEQEY
LNDMMKNYDKSLQKYFWTGLRDADSRGEYSWAVAGGAKQAVTFSNWNFLEPASPGGCVAM
STGKTLGKWEVKNCRSFRALSICKKMRGPQASEEAAPKPDDPCPEGWHTFPSSLSCYKVF
HIERIVRKRNWEEAERFCRALGAHLPSFSHRSEIKDLVHLLKDQFSGQRWLWIGLNKRSP
DLQGSWQWSDRTPVSAVIMDWEFQQDYDIRDCAAVKVLDTPWHRAWHFYDEREYAYLKPF
ACDAKLEWVCQIPKGSTPQMPDWYNPERTGIHGPPVIIEGSEYWFVADPHLNYEEAVLYC
ASNQSFLATITSFTGLKAIKNKIANVI
Download sequence
Identical sequences ENSRNOP00000065665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]