SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000065882 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000065882
Domain Number 1 Region: 413-901
Classification Level Classification E-value
Superfamily ALDH-like 5.89e-131
Family ALDH-like 0.00000000826
Further Details:      
 
Domain Number 2 Region: 1-201
Classification Level Classification E-value
Superfamily Formyltransferase 8.5e-52
Family Formyltransferase 0.00000000225
Further Details:      
 
Domain Number 3 Region: 205-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 4.55e-27
Family Post formyltransferase domain 0.000000869
Further Details:      
 
Domain Number 4 Region: 325-411
Classification Level Classification E-value
Superfamily ACP-like 0.0000198
Family Acyl-carrier protein (ACP) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000065882   Gene: ENSRNOG00000047023   Transcript: ENSRNOT00000075042
Sequence length 902
Comment pep:known_by_projection chromosome:Rnor_5.0:4:186990816:187030720:1 gene:ENSRNOG00000047023 transcript:ENSRNOT00000075042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYCQLRKEGHEVVGVFTIPDKDGKADPLGLEAEKDGVPVFKFPRWR
ARGQALPEVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGTAPRCPQSEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTSGLSTQGEALPIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQLEDGKMM
PASQFFKGSASSDLELTEAELATAEAVRSSWMRILPNVPEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFRGFIQLLVRKLRGEDDESECVINYVEKAVNKLTLQM
PYQLFIGGEFVDAEGSKTYNTINPTDGSVSRTVARGLCLGVCVLTADMQGHGRGIEQEDE
ERGERGQLLARLADVMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCALSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEESIH
NQFVQKVESELEGQAAGGAMVPSEEWLGKNRKAETRMNRVLCEPVPSQAYASNVHQSTVS
PAGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFT
RDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTVTF
EY
Download sequence
Identical sequences ENSRNOP00000065882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]