SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066295 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066295
Domain Number 1 Region: 154-238
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 3.79e-19
Family Translation initiation factor IF3, C-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 76-145
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.000000000034
Family Translation initiation factor IF3, N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066295   Gene: ENSRNOG00000047329   Transcript: ENSRNOT00000075162
Sequence length 276
Comment pep:known chromosome:Rnor_5.0:12:11958153:11969303:1 gene:ENSRNOG00000047329 transcript:ENSRNOT00000075162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLLKRLMPQAMKTDSSLLRRCFRRHTVKPDLARPSLTASTPKLLHLISAKGFSTVGDT
EGERRQKRRDAFSNTGRKISERVIRVLDEKGVDLGTMHRADVIRLMDKQDLRLVQRNTTS
EPPEYQLMTGAQIHQERLRIREQEKAKPKTAGPTVTKELIFSSNIGQHDLDTKSKQIQQW
IEKKYHVQVTIKKRKDAEQPGSEMDEIFNQILQTMPGIATFLSRPKAVRGGTASMCVFRH
VSKKEEKAYRESQESQKGDTLSKDDRSSNKSDVLCQ
Download sequence
Identical sequences B0BNE9
ENSRNOP00000066295 NP_001108513.2.100692 NP_001108513.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]