SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066388 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066388
Domain Number 1 Region: 30-289
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.04e-86
Family Crotonase-like 0.000000000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066388   Gene: ENSRNOG00000047565   Transcript: ENSRNOT00000071574
Sequence length 290
Comment pep:known chromosome:Rnor_5.0:1:142777748:142786555:1 gene:ENSRNOG00000047565 transcript:ENSRNOT00000071574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRALLPRACNSLLSPVRCPEFRRFASGANFQYIITEKKGKNSSVGLIQLNRPKALNA
LCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSHW
DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMA
KESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH
Download sequence
Identical sequences P14604
ENSRNOP00000025446 NP_511178.1.100692 NP_511178.1.4139 XP_003748934.1.100692 ENSRNOP00000025446 ENSRNOP00000066388 10116.ENSRNOP00000025446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]