SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066430 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066430
Domain Number 1 Region: 497-797
Classification Level Classification E-value
Superfamily ALDH-like 6.54e-104
Family ALDH-like 0.0000000591
Further Details:      
 
Domain Number 2 Region: 309-443
Classification Level Classification E-value
Superfamily ALDH-like 1.21e-31
Family ALDH-like 0.0000644
Further Details:      
 
Domain Number 3 Region: 105-200
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.92e-23
Family Post formyltransferase domain 0.0000192
Further Details:      
 
Domain Number 4 Region: 218-306
Classification Level Classification E-value
Superfamily ACP-like 0.0000288
Family Acyl-carrier protein (ACP) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066430   Gene: ENSRNOG00000008586   Transcript: ENSRNOT00000072587
Sequence length 798
Comment pep:known_by_projection chromosome:Rnor_5.0:7:26514686:26555206:1 gene:ENSRNOG00000008586 transcript:ENSRNOT00000072587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKLALIGQSLFGQEVYSHLLKEGHRVVGVFTVPDKDGKADPLEREREREREREREIHWMT
SLGVACLTAQRNTNDLGAACYVFPSCSVYDRQEFAEPSMVAHVCNIPWDQPAEVLHNWIR
GHDKVPGAWAEIDGQMVTFYGSSLLTSSVPAGEPLDIRGAKKPGLVTKNGLVLFGNDGKA
LMVRNLQFEDGKMIPASQYFSSGETSVVELTAEELKVAETIKVIWARILSNVPVIEDSTD
FFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMARKFGDFIQKVVRRLRGEDQEAELVV
DYVSKEVNEMTVKMPYQCFINGQFVDAEDGETYATINPTDGTTLCRVSYASLADVDRAVA
AAKDAFENGEWGRMNARDRGRLMYRLADLMEENQEELATIEALDSGAVYTLALKTHIGMS
VQTFRYFAGWCDKIQLETLSRGNMADGNHILLWSPSLSRPTLMCMHLKYAPYPQMSAFTV
TKKGPGKDGDYCIHFQVTPLTALKFAELTVKAGFPKGVINIIPGSGGVAGQRLSQHPDIR
KLGFTGSTSVGKQIMKSCAVSNLKKVSLELGGKSPLIIFSDCELDKAVRMGMGAVFFNKG
ENCIAAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCET
GVKEGATLVYGGRQVQRPGFFMEPTVFTGVEDHMYLAKEESFGPIMVISKFQNGDIDGVL
QRANNTEYGLASGVFTRDISKAMYVSDRLEAGTVFINTYNKTDVAAPFGGVKQSGFGKDL
GEEALNEYLKTKTVTLEY
Download sequence
Identical sequences ENSRNOP00000066430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]