SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066497 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066497
Domain Number 1 Region: 172-473
Classification Level Classification E-value
Superfamily ALDH-like 5.5e-102
Family ALDH-like 0.0000000529
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily ALDH-like 9.82e-30
Family ALDH-like 0.0000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066497   Gene: ENSRNOG00000008586   Transcript: ENSRNOT00000075809
Sequence length 483
Comment pep:known_by_projection chromosome:Rnor_5.0:7:26533738:26554517:1 gene:ENSRNOG00000008586 transcript:ENSRNOT00000075809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FINGQFVDAEDGETYATINPTDGTTLCRVSYASLADVDRAVAAAKDAFENGEWGRMNARD
RGRLMYRLADLMEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAGWCDKIQTAT
PENNQRQCGGNLSRPTLMCMHLKYAPYPQMSAFTVTKKGPGKDGDYCIHFQVTPLTALKF
AELTVKAGFPKGVINIIPGSGGVAGQRLSQHPDIRKLGFTGSTSVGKQIMKSCAVSNLKK
VSLELGGKSPLIIFSDCELDKAVRMLQGMGAVFFNKGENCIAAGRLFVEEAIHDEFVTRV
VEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCETGVKEGATLVYGGRQVQRPGFFME
PTVFTGVEDHMYLAKEESFGPIMVISKFQNGDIDGVLQRANNTEYGLASGVFTRDISKAM
YVSDRLEAGTVFINTYNKTDVAAPFGGVKQSGFGKDLGEEALNEYLKTKTVTLEKPVTNS
PLL
Download sequence
Identical sequences ENSRNOP00000066497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]