SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066541 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066541
Domain Number 1 Region: 31-119
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.05e-24
Family Ribosomal L11/L12e N-terminal domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 108-179
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000000000497
Family Ribosomal protein L11, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066541   Gene: ENSRNOG00000030586   Transcript: ENSRNOT00000041852
Sequence length 197
Comment pep:novel chromosome:Rnor_5.0:8:90795417:90796097:1 gene:ENSRNOG00000030586 transcript:ENSRNOT00000041852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASRLLIMHRRKQKNSFIYKLLLRLYHRPKRCTMLPKFSPNEIKAVHLRCTGGKVGTTSA
LTPKVSPLGLSSKRVGAEIAKATSDWKVLRILVKLTTQNRQSQTEVVPSASALTIKALKE
PPRDRKKQKSIQHNGNVTFDEIANIAGQMRHQSLARELSGTIKEILGTAQSVGCNVDGLH
HDVIDDINSSAMECPAS
Download sequence
Identical sequences ENSRNOP00000066541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]