SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066553 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066553
Domain Number 1 Region: 9-191
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 8.63e-52
Family Isochorismatase-like hydrolases 0.0000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066553   Gene: ENSRNOG00000050348   Transcript: ENSRNOT00000071971
Sequence length 203
Comment pep:known_by_projection chromosome:Rnor_5.0:1:76040561:76044554:1 gene:ENSRNOG00000050348 transcript:ENSRNOT00000071971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARASLGRIRPESSILFLCDMQEKFRPSIAYFPQIVSVAARMLKVARLLDVPILLTEQ
YPQGLGPTVPELGAQGIKPVSKTCFSMVPSLQKELDRRSQLQSVLLCGIETQACILNTVL
DLLDRGLQVHVVVDACSSRSQIDRLVALGRMRQSGAFLSTSESLILQLVRDAAHPQFKEI
QKIIKEPAPDSGLLGLFQGQNPL
Download sequence
Identical sequences ENSRNOP00000066553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]