SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066737 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066737
Domain Number 1 Region: 27-155
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 9.43e-33
Family MaoC-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066737   Gene: ENSRNOG00000047972   Transcript: ENSRNOT00000070948
Sequence length 158
Comment pep:known chromosome:Rnor_5.0:15:22592972:22593448:-1 gene:ENSRNOG00000047972 transcript:ENSRNOT00000070948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSGLQRRLWQHRVVPTGQCFRCVHMKVGDRAELSRAFTQQDVATFSELTGDANPLHLSE
DFAKHTRFGKTVVHGVLINGLISALLGTKMPGPGCVFLSQEIKFPAPLYIGEVVLASAEV
KRLKQSVAVVEVSCCVIESKKTVMEGLVKIMVPGAPRS
Download sequence
Identical sequences ENSRNOP00000066737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]