SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066784 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066784
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.22e-24
Family Mismatch glycosylase 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066784   Gene: ENSRNOG00000010919   Transcript: ENSRNOT00000071994
Sequence length 108
Comment pep:novel chromosome:Rnor_5.0:4:211029615:211031701:-1 gene:ENSRNOG00000010919 transcript:ENSRNOT00000071994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIPVLWEFLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKPWRYPI
ELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
Download sequence
Identical sequences ENSRNOP00000066784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]