SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066875 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066875
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily TRAF domain-like 4.09e-40
Family MATH domain 0.0000174
Further Details:      
 
Domain Number 2 Region: 168-268
Classification Level Classification E-value
Superfamily POZ domain 1.53e-27
Family BTB/POZ domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066875   Gene: ENSRNOG00000042221   Transcript: ENSRNOT00000073413
Sequence length 268
Comment pep:novel chromosome:Rnor_5.0:2:214758510:215034566:-1 gene:ENSRNOG00000042221 transcript:ENSRNOT00000073413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDLEAKICGYTHISVQRFCYKWTISNFSFCMDGIRENITSPVFSLEGNEEVQWFLRIF
PNGVDEESKDYLSVSVGLYSCPKSPVLAKVQFWIINAQGEKHQIKEIPNILSFSPKQQWG
LRKFILRDFLLSLRHWLLPEDQLILCCKVSVVGPSFSTPGHNMTPAKKDPRQKLADDIGE
LWENSLFTDCSLVVAGQEFRAHKAILAARSPVFRAMFEHEMLDSLRNRIEIHDIHLQVFK
EMMHFIYTGTVPHLHNHSMATGLLAAAD
Download sequence
Identical sequences ENSRNOP00000066875 ENSRNOP00000067548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]