SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000066968 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000066968
Domain Number 1 Region: 17-157
Classification Level Classification E-value
Superfamily TRAF domain-like 1.96e-42
Family MATH domain 0.0000138
Further Details:      
 
Domain Number 2 Region: 167-269
Classification Level Classification E-value
Superfamily POZ domain 1.73e-25
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000066968   Gene: ENSRNOG00000047767   Transcript: ENSRNOT00000070843
Sequence length 269
Comment pep:novel chromosome:Rnor_5.0:2:210084361:210510520:1 gene:ENSRNOG00000047767 transcript:ENSRNOT00000070843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDLEAKISGYTHISVQRFCYKWTISNFSFCMDGIRENITSPVFSLEGNEEVQWCLRIF
PNGVDEESKDYLSVSLGLHSCPKSPVLAKVQFWIINAQGEKYLITKISNVLKFLPNQYWG
YKKFILRDFLLSHRHWLLPEEQLILCCKVSIIGPCFSRPGQNMTPAIKDPRQILADDVGE
LWENSLFTDCSLVVAGQEFRAHKAILAGHSPVFRAMFEHEMQERLTNRIEFHDIHLQVFK
EMMAFIYTGKAPHLHSHSMATGLLAAADM
Download sequence
Identical sequences ENSRNOP00000066741 ENSRNOP00000066968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]