SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067125 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067125
Domain Number 1 Region: 117-173
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0000000298
Family Cystatins 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000067125
Domain Number - Region: 55-103
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0191
Family Cystatins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067125   Gene: ENSRNOG00000048021   Transcript: ENSRNOT00000073262
Sequence length 176
Comment pep:novel chromosome:Rnor_5.0:3:149731597:149743267:-1 gene:ENSRNOG00000048021 transcript:ENSRNOT00000073262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIPIGTLLLLAIFVLFLNFSHATAKTIMGGRENSKGNFIEKNKLNDVYDVFKFLYSKYSD
DTYLSNIKNQSFTMHIWEVGEIEMVKTTCKKTESDFHQCHLEREFYAIKKIRNSRVTMYY
IWLPGRVRCRKSRSNLGKCPFQEQTEELKREICYFQLYPHYYKQNVNAVRFYCYAE
Download sequence
Identical sequences ENSRNOP00000067125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]