SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067185 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000067185
Domain Number - Region: 68-142
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 0.051
Family LeuD-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067185   Gene: ENSRNOG00000026057   Transcript: ENSRNOT00000036161
Sequence length 260
Comment pep:known_by_projection chromosome:Rnor_5.0:1:259224017:259225340:1 gene:ENSRNOG00000026057 transcript:ENSRNOT00000036161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVCGPKRHLKCVSAPKHLMLDNLTAAFAPRPSIGPHELRECLPLISSLRNRLKYPLTGDE
VKKFCMQRFIKIDGKVRTDITYPAGFMVVIRIDKTGENFHLICDTKGRFAVHQTTPEEDT
YKLCKVKRSVGTKGIPHLVTHDACTFYHNPLIKVNDTIQIDLETGKIIDFIKFDTGNLCM
VAGGTYLGRSGITNIEMHPGSFDVVCMKDTNGSSFTTRLSNIFIIGKGNKPWVSLPQGKG
IRLTIAEERQEARREIEKLS
Download sequence
Identical sequences ENSRNOP00000067185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]