SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067528 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067528
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.93e-31
Family Ribosomal L11/L12e N-terminal domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 76-144
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000000000811
Family Ribosomal protein L11, C-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067528   Gene: ENSRNOG00000018084   Transcript: ENSRNOT00000024332
Sequence length 161
Comment pep:novel chromosome:Rnor_5.0:10:67050271:67051294:1 gene:ENSRNOG00000018084 transcript:ENSRNOT00000024332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNKIKVVYLRCTGGEVRTTSALAPKIGPLGLSPKKVGDDIAKATSDWKGLRITV
KLTIQNRQAQIEVVSSASALIIKALKEPPRDREKHYSANITFDKIINIAQQMRHWSLARE
LSGTIKEILGTAQSVGCNVDGHHPHDIIDDINSGAVACPAN
Download sequence
Identical sequences ENSRNOP00000067528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]