SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000067571 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000067571
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.11e-61
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 141-288
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 5.57e-59
Family GAPDH-like 0.00000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000067571   Gene: ENSRNOG00000030378   Transcript: ENSRNOT00000042076
Sequence length 288
Comment pep:novel chromosome:Rnor_5.0:1:149425729:149426631:1 gene:ENSRNOG00000030378 transcript:ENSRNOT00000042076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKVGVNEFGLIGLLVTRAAFCSASGKVEILAINDPFIDINYMVYMLSMTHGKFNSTVKT
ENGKFVINRKPMTIFQERDPTNIKWGDADAEYVVESSGIYTTMEKAWAHLKSGAKRVIIF
VPLSNPMFVFVVNHENNASCTNCLSPAANVIHDNFGVMEGLMTTLHAITATQKTVDGPSG
KLWSDGHGAAQNIPCKVNPELNGKLTGMAFHVPTPNVSVVYLTCCLEKPAKNSDIKKVVK
QESEGPLKGIQGYTEDQVVSCDFNSNYSSTFDAGASIAPNDNIVKLIS
Download sequence
Identical sequences ENSRNOP00000067571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]