SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001012 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001012
Domain Number 1 Region: 65-122
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 5.67e-17
Family Transcriptional factor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000001012
Domain Number - Region: 12-41
Classification Level Classification E-value
Superfamily RING/U-box 0.00353
Family RING finger domain, C3HC4 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001012   Gene: ENSRNOG00000000779   Transcript: ENSRNOT00000001012
Sequence length 123
Comment pep:known chromosome:Rnor_5.0:20:4125232:4129150:1 gene:ENSRNOG00000000779 transcript:ENSRNOT00000001012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELARPCSNFQSDLDFCPDCGSVLPLPGVQDTVICPRCGFSIDVRDFGGKVVKTSVVFNK
LGTVIPMSVDEGPESQGPVVDRRCSRCGHEGMAYYTRQMRSADEGQTVFYTCINCKFQEK
EDS
Download sequence
Identical sequences Q6MFY5
ENSRNOP00000001012 10116.ENSRNOP00000001012 NP_001159772.1.100692 NP_001159772.1.4139 NP_998732.1.100692 NP_998732.1.4139 ENSRNOP00000001012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]