SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002450 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000002450
Domain Number 1 Region: 237-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.42e-56
Family Decarboxylase 0.000000526
Further Details:      
 
Domain Number 2 Region: 11-205
Classification Level Classification E-value
Superfamily PRTase-like 6.46e-44
Family Phosphoribosyltransferases (PRTases) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002450   Gene: ENSRNOG00000001797   Transcript: ENSRNOT00000002450
Sequence length 481
Comment pep:known chromosome:Rnor_5.0:11:73123827:73134236:1 gene:ENSRNOG00000001797 transcript:ENSRNOT00000002450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVARQALGPLVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQT
ARNAGISFDSVCGVPYTALPLATVICSANHIPMLIRRKETKDYGTKRLVEGEINPGQTCL
VIEDVVTSGASVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAQGIRLHSVCTLSEML
EILEQQKKIDAEMVGRVKRFIQENVFTAANHNGVPPPEKKACKELSFGARAELPGVHPLA
SKLLTLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTT
LAKRHEFLIFEDRKFADIGNTVKKQYESGIFKIASWADVVNAHVVPGSGVVKGLQEVGLP
LHRACLLIAEMSSAGSLATGDYTKAAVGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQ
LETGGDHLGQQYNSPQEVVGKRGSDVIIVGRGILAAANRLEAAEMYRKAAWEAYLSRLAV
Q
Download sequence
Identical sequences Q4QQS7
ENSRNOP00000002450 NP_001020573.1.100692 NP_001020573.1.4139 ENSRNOP00000002450 10116.ENSRNOP00000002450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]