SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014269 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014269
Domain Number 1 Region: 8-320
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.2e-59
Family Quinoprotein alcohol dehydrogenase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014269   Gene: ENSRNOG00000009667   Transcript: ENSRNOT00000014269
Sequence length 326
Comment pep:known chromosome:Rnor_5.0:10:13656236:13661987:-1 gene:ENSRNOG00000009667 transcript:ENSRNOT00000014269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTTPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEITPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVSKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEFSITSAHIDP
DASYMAAVNSAGNCFVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG
Download sequence
Identical sequences G3V7F1
ENSRNOP00000014269 ENSRNOP00000014269 10116.ENSRNOP00000014269 NP_071799.2.100692 NP_071799.2.4139 XP_017453011.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]