SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016893 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016893
Domain Number 1 Region: 88-193
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.000000041
Family Deoxycytidylate deaminase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016893   Gene: ENSRNOG00000012303   Transcript: ENSRNOT00000016893
Sequence length 224
Comment pep:known chromosome:Rnor_5.0:9:13451685:13465230:1 gene:ENSRNOG00000012303 transcript:ENSRNOT00000016893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKEEAAEAAAPASQNGDDLENLEDPEKLKELIDLPPFEIVTGVRLPVNFFKFQFRNVE
YSSGRNKTFLCYVVEAQSKGGQVQATQGYLEDEHAGAHAEEAFFNTILPAFDPALKYNVT
WYVSSSPCAACADRILKTLSKTKNLRLLILVSRLFMWEEPEVQAALKKLKEAGCKLRIMK
PQDFEYLWQNFVEQEEGESKAFEPWEDIQENFLYYEEKLADILK
Download sequence
Identical sequences B4F789
10116.ENSRNOP00000016893 NP_001100353.1.100692 NP_001100353.1.4139 ENSRNOP00000016893 ENSRNOP00000016893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]