SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019707 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019707
Domain Number 1 Region: 132-226
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.44e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 25-119
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 6.87e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019707   Gene: ENSRNOG00000014633   Transcript: ENSRNOT00000019707
Sequence length 228
Comment pep:known chromosome:Rnor_5.0:7:117672422:117676270:-1 gene:ENSRNOG00000014633 transcript:ENSRNOT00000019707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGVGALPCSVAAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALE
KAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKED
RPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPD
FEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHS
Download sequence
Identical sequences B5DEN9
ENSRNOP00000019707 ENSRNOP00000019707 10116.ENSRNOP00000019707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]