SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021036 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021036
Domain Number 1 Region: 14-144
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 5.27e-49
Family Cytidine deaminase 0.000000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021036   Gene: ENSRNOG00000015677   Transcript: ENSRNOT00000021036
Sequence length 146
Comment pep:known chromosome:Rnor_5.0:5:160452101:160482729:-1 gene:ENSRNOG00000015677 transcript:ENSRNOT00000021036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNVENACY
PLGVCAERTAIQKAISEGYKDFRAIAIASDLQEEFISPCGACRQVMREFGTNWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIH
Download sequence
Identical sequences D4AC20
ENSRNOP00000021036 NP_001102158.1.100692 NP_001102158.1.4139 XP_003750114.1.100692 10116.ENSRNOP00000021036 ENSRNOP00000021036 ENSRNOP00000065378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]