SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021105 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021105
Domain Number 1 Region: 202-592
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.21e-144
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000000000237
Further Details:      
 
Domain Number 2 Region: 6-197
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.57e-67
Family Inosicase 0.0000000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021105   Gene: ENSRNOG00000015511   Transcript: ENSRNOT00000021105
Sequence length 592
Comment pep:known chromosome:Rnor_5.0:9:78636339:78656386:1 gene:ENSRNOG00000015511 transcript:ENSRNOT00000021105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSQLALFSVSDKTGLVEFARNLASLGLSLVASGGTAKAIRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLIRVVVCNLYPFVKTVASPDVTVEAA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYGAVAAEMQGSGNKDTSLETRRHLALKAFT
HTAQYDEAISDYFRRQYSKGISQMPLRYGMNPHQTPAQLYTLKPKLPITVLNGAPGFINL
CDALNAWQLVTELRGAVDIPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLA
IAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNG
SYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIV
ATIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKA
GVKRAEVSNAIDQYVTGTIGEGEDLVKWKALFEEVPELLTEAEKKEWVDKLSGVSVSSDA
FFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLRLFHH
Download sequence
Identical sequences O35567
ENSRNOP00000021105 ENSRNOP00000021105 NP_112276.2.100692 NP_112276.2.4139 10116.ENSRNOP00000021105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]