SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021591 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021591
Domain Number 1 Region: 313-449
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000127
Family CBS-domain pair 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000021591
Domain Number - Region: 545-596,627-653
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000249
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021591   Gene: ENSRNOG00000016032   Transcript: ENSRNOT00000021592
Sequence length 711
Comment pep:known chromosome:Rnor_5.0:9:42747044:42762392:1 gene:ENSRNOG00000016032 transcript:ENSRNOT00000021592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAVAGWLGWVLAAFCLGSTAGEAAPGAGLLSFCTEEDGAPGAGSLRGRAAPEATL
CLRLFCPGLANSSWTWVAPEGAGCPEGGRATEPSEAAAPTGEWRALLRLRAEAGHPRSAL
LAVRVEPGGGAAEEAAAPWALGLGAAGLLALAAVARGLQLSALALAPAEVQVLRESGSEA
ERAAARRLEPARRWAGCALGALLLLASLAQAALAVLLYGAVGQRAVPAVLGCAGLVFLVG
EVLPAAVSGRWALALAPRALGLSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELARG
GGDPYSDLSKGVLRYRTVEDVLTPLEDCFMLDSGTVLDFSVLASIMQSGHTRIPVFEEER
SNIVDMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIV
QKVNNEGEGDPFYEVLGLVTLEDVIEEIIRSEILDESEDYSDTKVKKKAVTLGAPLKRKE
EFSLFKVSDDEYKVKISPQLLLATQRFLSREVDVFSPLRISEKVLLHLLKHPSVNQEVKF
DESNRLATHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGVSALTAPSSA
HQSPVSSRQLIRHDLQPEPADSTRSCTYCPDYTVRALSDLQLIKVTRLQYLNALLATRAQ
SLPPSPENAELQAIPGSQTRLLGDKSRETAGPSSSRRSIPVEESPGRNPGV
Download sequence
Identical sequences D4ACK7
10116.ENSRNOP00000021591 ENSRNOP00000021591 NP_001100371.2.100692 NP_001100371.2.4139 ENSRNOP00000056548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]