SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021876 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021876
Domain Number 1 Region: 51-196
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000109
Family CBS-domain pair 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000021876
Domain Number - Region: 287-343
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00216
Family cAMP-binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021876   Gene: ENSRNOG00000016302   Transcript: ENSRNOT00000021876
Sequence length 584
Comment pep:known chromosome:Rnor_5.0:1:270631411:270687644:1 gene:ENSRNOG00000016302 transcript:ENSRNOT00000021876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAFPVCYPLGRLLDWALRQEISTFYTREKLLETLRAADPYSDLVKEELNIIQGALELR
TKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILFVKDLA
FVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQRVNNEGEGDPFY
EVMGIVTLEDIIEEIIKSEILDETDLYTDNRKKQRVPHRERRRHDFSLFKLSDSEIRVKI
SPQLLLATHRFMATEVEPFKSLYLSEKILLRLLKHPNVIQELKFDERNKKAPEHYLYQRS
RPVDYFVLLLQGKVEVEVGKEGLRFENGAFTYYGVPAIMTSACSDNDVRKVGSLAGSSVF
LNRSPSRCSGLNRSESPNRERSDFGGSNTQLCSNNLYTPDYSVHILSDVQFVKITRQQYQ
NALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPVLTLLSNRTSLPCSRSDG
LRSPGEVVYLRMEEMAFPQEEMPNFEEHKAQQVSLSPVTVPTAAASETECCNIHLDPEAS
PCSSDSEETMGKKLLRTLSGRKRKKSADGERASEENSNLTPLIT
Download sequence
Identical sequences D4A1C0
NP_001101063.1.100692 NP_001101063.1.4139 ENSRNOP00000021876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]