SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022724 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022724
Domain Number 1 Region: 19-142
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000117
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000022724
Domain Number - Region: 380-418
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0325
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022724   Gene: ENSRNOG00000016926   Transcript: ENSRNOT00000022724
Sequence length 469
Comment pep:known chromosome:Rnor_5.0:1:284642638:284672327:1 gene:ENSRNOG00000016926 transcript:ENSRNOT00000022724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARPPKGPGKQFTFDYENEVHKRDYFIKSPPPQLFFSATSWKKRLFILSQSQGKGLSLS
YYKDHHRRGSIEIDGSATVEVGINSQEKMQSVQKMFKCHPDEVMCIRTVTRDYFLIGRDR
EKIKDWVSFMTPYCRGVKATHQRAEEKPSLGDRRPVSDPSPFLGLCNIPEGISLASPRAS
LPEHLIQKSLQRFRQDHYHHEHDFYSEPTQDAEEEEYYLTPRSLENIDGANDSGDSAESN
SPDQGFKRAESNYVSMRSMRSCLVKEATSAPADCQAEFQISPETSELGPPHQEQDTGSDP
CLLPADSEAQTTDDQQGSASLTVVKLSILLNNITDESQVETLNVFLSPRDVINYLALVEA
AGRICVARWEGPPRLGCLFHHGDHILAVNDLKPQSLEEVSLFLTRCIQKEKVKLSIGRIP
NSEKLHAFPCACSLRHQFAESAQQDLPGRERTPKRSPAIKKNQKEAIGE
Download sequence
Identical sequences D3ZM82
10116.ENSRNOP00000022724 NP_001128085.1.100692 NP_001128085.1.4139 ENSRNOP00000022724 ENSRNOP00000022724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]