SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034775 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034775
Domain Number 1 Region: 396-784
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.1e-133
Family Ankyrin repeat 0.000000000176
Further Details:      
 
Domain Number 2 Region: 161-414
Classification Level Classification E-value
Superfamily Ankyrin repeat 4e-74
Family Ankyrin repeat 0.00000265
Further Details:      
 
Domain Number 3 Region: 8-237
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.73e-59
Family Ankyrin repeat 0.0000142
Further Details:      
 
Domain Number 4 Region: 1399-1509
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-26
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034775   Gene: ENSRNOG00000024011   Transcript: ENSRNOT00000031134
Sequence length 1964
Comment pep:known chromosome:Rnor_5.0:20:22394391:22609934:1 gene:ENSRNOG00000024011 transcript:ENSRNOT00000031134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREA
NVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRF
LLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAA
ALLLQNDTNADIESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKR
GNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPL
HMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKAL
NGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS
PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQL
LQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKL
EVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIA
AKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGL
TPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNA
KTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV
TEEIMTTTTITEKHKMNVPETMNEVLDMSDDEGEDAITGDTDKYLGPQDLKELGDDSLPA
EGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLPFTREFDSDS
LRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTR
ITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIV
LRSENGETWKEHQFDSKNEDLSELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSR
IKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATF
SPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWED
ITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAK
TNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKG
GQQLVFNFYSFKENRLPFSIKVRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAH
KKAEKADRRQSFTSLALRPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRV
ENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTR
SFADENNVFHDPVDGHPSFQVELETPMGLYCTPPTPFQQDDHFSDNSSIESPFRTPSRLS
DGLMPSQGSIEHPAGGPPVVTAEDTSLEDSKMDDSVTVTETADPLDVDESQLKDLCQSEC
AHCWASVPGVPSGGPQAEPLRAQTRKVGVSSEQQEKGDSGPEEEMADDKVRSLFEDIQLE
EVEAEEMTEDEGQAILNRVPRAELAMSSLAGWQNETPSGSLESPAQARRITGGLLDRLDD
SSDQVRDPITSYLTGEAGKFEANGNHAEVIPEAKAKAYFPESQNDIGKQSIKENLKPKTH
GCGRAEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTPADGKARLNLQEEEG
SARSEPKDLRHSESDSSSEEERRVTTRVIRRRVIIKGEEAKTIPGESVTEEQFTDEEGNL
ITRKITRKVIRRIGPQERKQDDVQGEGYKVKTKKEIRNVEKKAH
Download sequence
Identical sequences ENSRNOP00000034775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]