SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043687 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043687
Domain Number 1 Region: 442-830
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-132
Family Ankyrin repeat 0.000000000176
Further Details:      
 
Domain Number 2 Region: 198-457
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-70
Family Ankyrin repeat 0.00000418
Further Details:      
 
Domain Number 3 Region: 45-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.45e-48
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 2324-2434
Classification Level Classification E-value
Superfamily DEATH domain 6.77e-26
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043687   Gene: ENSRNOG00000024011   Transcript: ENSRNOT00000043215
Sequence length 2598
Comment pep:known chromosome:Rnor_5.0:20:22243056:22583368:1 gene:ENSRNOG00000024011 transcript:ENSRNOT00000043215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINAEEETEKKKKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKLSIGRAR
KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGA
KIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQL
LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNR
IRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHM
AARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSG
YTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPD
AAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE
YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNV
AEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQ
QGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKH
KMNVPETMNEVLDMSDDEVGKASAPEKLSDGEYISDGEEGEDAITGDTDKYLGPQDLKEL
GDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLPFT
REFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPR
KCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRG
KERELIVLRSENGETWKEHQFDSKNEDLSELLNGMDEELDSPEELGTKRICRIITKDFPQ
YFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKI
LGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPSLRLLCSITGGT
SPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMA
KFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGN
LAPLTKGGQQLVFNFYSFKENRLPFSIKVRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNL
NITLPAHKKAEKADRRQSFTSLALRKRYSYLTEPSMKTVERSSGTARSLPTTYSHKPFFS
TRPYQSWTTTPLTVPGPAKSGSLSSSPSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSV
KSISDVASPIRSFRTISSPIRTSVSTPSPIKSTLGASTTSSVKSISDVAPIKGLAPNSTL
SSRTSPVTTAGSLLERSSITMTPPASPKANITMYSSSLPFKSIITSAAPLISSPLKSVVS
PTKSAAKAAMASTLSSPLKQMSGHAEVALVNGSVSPLKYPSSSALINGCKATATLQDKIS
TATNAVSSVVSAAPDTVEKALSTTTAMPFSPLRSYVSAAAPSAFQSLRAPSASALYTSLG
PSVAVTTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSLTKSAAALLSPIKTLTTETRP
QPHFNRTSSPVKSSLFLASSALKPSVPSSLSSSQEILKDVAEMKEDLMRMTAILQTDVPE
EKPFQTDLPREGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVESKGPPKSPKSDKGHSP
EDDWTEFSSEEIREARQAAASHAPSLPERVHGKANLTRVIDYLTNDIGSSSLTNLKYKFE
EAKKEGEERQKRILKPAMALQEHKLKMPPASMRPSTSEKELCKMADSFFGTDAILESPDD
FSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPVITETRTEVVHVIR
SYEPSTGEIPQSQPEDPVSPKPPPTFMELEPKPTAPSIKEKVKAFQMKASSEEEDHSRVL
SKGMRVKEETHITTTTRMVYHSPPGSECASERIEETMSVHDIMKAFQSGRDPSKELAGLF
EHKSAMSPDVAKSAAETSAQHAEKDNQMKPKLERIIEVHIEKGPQSPCERTDIRMAIVAD
HLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLT
KINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGWQNETPSGSLESPAQARRIT
GGLLDRLDDSSDQVRDPITSYLTGEAGKFEANGNHAEVIPEAKAKAYFPESQNDIGKQSI
KENLKPKTHGCGRAEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTPADGKA
RLNLQEEEGSARSEPKQG
Download sequence
Identical sequences ENSRNOP00000043687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]