SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000046194 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000046194
Domain Number 1 Region: 777-967
Classification Level Classification E-value
Superfamily Macro domain-like 8.92e-55
Family Macro domain 0.0000915
Further Details:      
 
Domain Number 2 Region: 1606-1786
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.8e-42
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 995-1176
Classification Level Classification E-value
Superfamily Macro domain-like 7.23e-41
Family Macro domain 0.00018
Further Details:      
 
Domain Number 4 Region: 1190-1375
Classification Level Classification E-value
Superfamily Macro domain-like 1.85e-37
Family Macro domain 0.0012
Further Details:      
 
Domain Number 5 Region: 1479-1587
Classification Level Classification E-value
Superfamily WWE domain 5.36e-18
Family WWE domain 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000046194
Domain Number - Region: 217-298
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000311
Family Canonical RBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000046194   Gene: ENSRNOG00000023334   Transcript: ENSRNOT00000046888
Sequence length 1787
Comment pep:known chromosome:Rnor_5.0:11:71194913:71226980:1 gene:ENSRNOG00000023334 transcript:ENSRNOT00000046888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGPFPLLVEGSWGPDPPKNLINKLQMYFQSRKKSGGGECEVVPEPGNPARFLVLFSP
EDVRQNVLEKENHELVWQGKGTFKMTVQLPADPGQASVSKKAIPEEESKTKEDAVKPGDL
DTTPSPSSRSEEMEDVPKECENISSMVAFEQLPEKVSEMVLTFLVENISGLPSDDFKVEL
IRDFAVAVVTFQKPIDTKKFIIDCISHRSNQQLQLVPRLLETTNVVRVENLPPGVDDYQL
QLFFENPFNGGGRVARVECFPEESSALVEFCDSKVLDTIMAKKHSFNKMPLSVFPYYPSL
GTALYGEEKPLVKLPASFQESLDLPLWKFFQKNDHLMEEINDEMRHCHCELTWSEINGKL
TVRPAATLVSHRPSIKTWQRDASAALSGIRSKYDVMVFEVCSPVWDIIKHELGDDRVLIE
FEKESLNVAGKSEDVQGISQQIRELIERTTEKLRREEQSLEEKVAISSGKHFLLYHSGFL
KDLSKEYPEMEISYDATAQYLCIKGLRADVYKVKCEIQEKVFSMAQKNVPVSSEVFRFLQ
QVDGQRLSNALFKAQNILATYELKDNALFLIGSSPKDLAEAEAKMLSALSHKHIEVEDKE
VLRSNVWKKKIHPLQKRHGSYAAIMVKNELTSGVPAEVVIAGCVKEVNEIHRQLFEFLEN
HMKVERVVKIDPPLIIDYLKTDKRLLSKTKKANVSVSFKTKDDPNSILLLGSKSKVLECL
DTVKEIRDSVCVRKFQTDKAGARHFFQDKEFYYKMEIRRLYGCIVELKEGEEGEEDSLKE
QKCYLQRDIGPGVTLIVHEGDLSLFPVDVVVNAANESLKHIDGLAGTLSKAAGPSLQAEC
DLIVKKGGMVPPGNAVISKAGKLPCRYVIHAVGPRWKGDKVLECVNLLKKAVKQSLTLAE
EYKCQSIAIPAISSGIFDFPLDLCVASIASAIKDNVQQKQNTHSVKKIYLVDVSAKVAKA
FAEAVKTTYRDILSPASVKALVPPGKMPQKQGKLLVSPEGLNIRLIEEGVQNAEAHAIVN
SVSSDLILNKGPLSQAFLESAGPELQEELTKAGQGVSVSVGTVLQTSGCNLNSRSIFHVV
TPPWKSNNSEWSLKIMKNIIRDCLRTTEDLSLQSIAFPAIGTGNLGFPKPEFAKLIISEV
LKFSSRNQLKTLQEVQFLLHPKDHENIQAFLDEFDKRSNGDPSSKNPKAEDTQGIYGSLS
SPTLGVHEMNIGPILFQVATGDIIKEVADVIVNSTSCTFNLKSGVSKAILEGAGQNVEQE
CSRLAQQGKEYIVTGGGLLKCKSIIHVDGGNDVKRSVSCILEECEQRSFSSICLPAIGTG
SAQQDPKVVAKAVLDAIEEFVQKKSVQAVKRVKVVIFQPHILQFFYDNMKEREGSPAPVK
PSVMSKIASFLGFPTQASPPKNTLVLEKKIELTVFQICGPGVDSVEGTISWLKSLITKEQ
FSFTNEDECVRDFDTEEYRKLNEMQKRLNIIIELNQKKPLIKVSGISRDVVEARDEIDNM
VKSIRLAKEKENQADYVSTFVEWQYIANNTTRCFDKIANMQLEDAWKAKKKHTVVKIQNQ
DFTVDLSTNTATAPQGLSFTVQRLLKAEAEIPANWSDMKQNKLLVVSLQTSDAEYTMVSR
AFHQTCPNFVIEKIERIQNPALWRRYQAYKKIMDEKNGNVINEKQLFHGTEFGSLAQLNS
NGFNRSYAGKNATAYGKGTYFAVNASYSAHDTYSKPDANGKKYMYYVRVLTGNYTQGNAS
LIVPPSRDPQNATDLFDTVADNVINPSIFVVFYDNQAYPEYLITFRK
Download sequence
Identical sequences F1LZ05
ENSRNOP00000046194 NP_001178588.1.100692 NP_001178588.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]