SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000051170 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000051170
Domain Number 1 Region: 374-728
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-83
Family Protein kinases, catalytic subunit 0.00000197
Further Details:      
 
Domain Number 2 Region: 187-287
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 1.1e-44
Family MAST3 pre-PK domain-like 0.0000136
Further Details:      
 
Domain Number 3 Region: 960-1059
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-19
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000051170   Gene: ENSRNOG00000003469   Transcript: ENSRNOT00000046414
Sequence length 1570
Comment pep:known chromosome:Rnor_5.0:19:37001666:37029385:-1 gene:ENSRNOG00000003469 transcript:ENSRNOT00000046414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSLWTALSNFSMPSFPGGSMFRRTKSCRTSNRKSLILTSTSPTLPRPHSPLPGHLGSS
PLDSPRNFSPNTPAHFSFASSRRADGRRWSLASLPSSGYGTNTPSSTVSSSCSSQERLHQ
LPYQPTVDELHFLSKHFGSTESITDEDGGRRSPAVRPRSRSLSPGRSPSSYDNEIVMMNH
VYKERFPKATAQMEEKLRDFARAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLI
TTVYFYELQENLEKLLQDAYERSESLEVAFVTQLVKKLLIIISRPARLLECLEFNPEEFY
HLLEAAEGHAKEGHLVKTDIPRYIIRQLGLTRDPFPDVVRLEEQDSGGSNTPEQDDTSEG
RSSTSKAKKPPGESDFDTIKLISNGAYGAVYLVRHRDTRQRFAMKKINKQNLILRNQIQQ
AFVERDILTFAENPFVVGMFCSFETRRHLCMVMEYVEGGDCATLLKNIGALPVEMARMYF
AETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKMGLMSLTTNLYEGHIEKD
AREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQ
VISDDILWPEGDEALPTDAQLLISSLLQTNPLVRLGAGGAFEVKQHSFFRDLDWTGLLRQ
KAEFIPHLESEDDTSYFDTRSDRYHHVNSYDEDDTTEEEPVEIRQFSSCSPRFSKVYSSM
EQLSQHEPKTPVSASGASKRDPNAKGPEEKVAGKREGLGGLTLREKTWRGGSPEIKRFSA
SEASFLEGEASPPLGARRRFSALLEPSRFTAPQEDEDEARLRRPPRPSSDPPSSLDTRVP
KEAAQGEGTSTPGEPEATERSHPGDFCPPSKDGDPSGPRATNDLVLRRARHQQLSGDLSV
EKRPSRTGGKVIKSASATALSVMIPAVDPHGGSPLASPMSPRSLSSNPSSRDSSPSRDYS
PAVSGLRSPITIQRSGKKYGFTLRAIRVYMGDSDVYSVHHIVWHVEEGGPAQEAGLCAGD
LITHVNGEPVHGMVHPEVVELILKSGNKVAVTTTPFENTSIRIGPARRSSYKAKMARRNK
RPSAKDGQERGHEFKSQQPHGGSQPSVTRSNTLFWCVRSLSSSDSLPGSPTHGLPARSPT
HSYRSTPDSAYLGASSQSSSPASSTPNSPASSASHHIRPSTLHGLSPKLHRQYRSARCKS
AGNIPLSPLAHTPSPTQASPPPLPGHTVGSSHTTQSFPAKLHSSPPIVRPRPKSAEPPRS
PLLKRVQSAEKLGASLGADKKGALRKHSLEVGHPDFRKDFHGELALHSLAESDGETPPIE
GPGATRQVAMRRLGRQESPLSLGADPLLPDGVQRPMASGKEDSAGGTEACTPPRATTPGS
RTLERDLGCTRHQSVQTEDGPGGVARALAKAALSPVQEHETGRRSSSGEAGTPPVPIVVE
PARPGVKTQTPQPLGTDSKGLKEPVAQIPLVPDAPRVRERWVLEEVEERTTLSGPRSKPA
SPKLSPDPQTPTVAPTKNVPRSAAPPVPPASLMVPGTKPEAGSNSRCPAEGVASAGLTKT
GAPSPASLGP
Download sequence
Identical sequences 10116.ENSRNOP00000051170 ENSRNOP00000051170 ENSRNOP00000051170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]