SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000051583 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000051583
Domain Number 1 Region: 433-577
Classification Level Classification E-value
Superfamily CBS-domain pair 4.64e-16
Family CBS-domain pair 0.01
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000051583
Domain Number - Region: 670-719
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000636
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000051583   Gene: ENSRNOG00000020113   Transcript: ENSRNOT00000054699
Sequence length 875
Comment pep:known chromosome:Rnor_5.0:1:273961301:274079325:1 gene:ENSRNOG00000020113 transcript:ENSRNOT00000054699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGCGACEPEVKMAGGQAAAALPTWKMAARRSLSARGRGVLQAAAGRLLPLLLLSCCCSA
GGCTAAGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNINNETWSRIAF
TEHERRRHTPGERGLGGPAPPEPDSGPQRCGIRTSDIIILPHIILNRRTSGIIEIEIKPL
RKMEKSKSYYLCTSLSTPALGAGGSGSASGTVGGKGGAGVAGLPPPPWAETTWIYHDGED
TKMIVGEEKKFLLPFWLQVIFISLLLCLSGMFSGLNLGLMALDPMELRIVQNCGTEKEKN
YAKRIEPVRRQGNYLLCSLLLGNVLVNTTLTILLDDIAGSGLVAVVVSTIGIVIFGEIVP
QAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRV
TDPYNDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTR
IPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKK
GKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSEILDETDLYTDNRTKKKVAHR
ERKQDFSAFKQTDSETKVKISPQLLLAMHRFLATEVEAFSPSQMSEKILLRLLKHPNVIQ
ELKYDEKNKKAPECYLYQRNKPVDYFVLILQGKVEVEAGKEGMKFEASAFSYYGVMALTA
SPVPLSLSRTFVVSRTEVLAAGSPGENKSPPRPCGLNHSDSLSRSDRIDAMTPTLGSSNN
QLSSSFLQVYIPDYSVRALSDLQFVKISRQQYQNALMASRMDKTPQSSDSENTKIELTLT
EMHDGLPDETANLLNEQNCVSHNKANHSLHSEGAI
Download sequence
Identical sequences Q5U2P1
10116.ENSRNOP00000051583 ENSRNOP00000027307 NP_001011942.1.100692 NP_001011942.1.4139 ENSRNOP00000051583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]