SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052477 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052477
Domain Number 1 Region: 421-792
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.94e-121
Family Ankyrin repeat 0.00000000101
Further Details:      
 
Domain Number 2 Region: 168-391
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.4e-63
Family Ankyrin repeat 0.00002
Further Details:      
 
Domain Number 3 Region: 7-195
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-47
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 4 Region: 3528-3628
Classification Level Classification E-value
Superfamily DEATH domain 4.42e-25
Family DEATH domain, DD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052477   Gene: ENSRNOG00000011076   Transcript: ENSRNOT00000055615
Sequence length 3903
Comment pep:known_by_projection chromosome:Rnor_5.0:2:250582256:250757478:-1 gene:ENSRNOG00000011076 transcript:ENSRNOT00000055615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRG
SSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVK
YLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKS
AALLLQNDHNADVQSKVRAEVKTQDGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGI
TPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLA
RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDK
RANPNARALNGFTPLHIACKKNRIKVMELLKHAIPTQASSKTDIRPMQQLKNISHMSSHS
LISQQKKTNQTNDCRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLG
KTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLH
VAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKN
GYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLEKGANI
HMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAYTKLGYTPLIVACHYGNVKMVNFLL
KQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYIS
VVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGERAPNTSAGQRLKLPDRQ
WRHTCLLPASLFCDTDILVESGRWGRELKRIPHSDRSHTLSHASYLRDSAMIDDTVVIPS
HQVSALAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLR
IIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAP
PPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFC
EYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGV
LSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFH
KPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVS
FTTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMT
DDKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENR
LPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYAKESESDQEQEEEVI
LQQQHYDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAG
SIKVKELAKAGEEEPGEPFEIVERVKEDLEKVNAILRSGTYMRDEGSVRSSQSERELEEE
WVIVSDEEIEEAKQHAPVEIAEHPCVEVRVDRETKTKVEKDSTGLVNYLTDDLNSYTGTH
EKKPQTAPEKSGETSQASAIVKSSESNKGKTSPAEEKQSAQKQVKPSLVIKKPVRRKLKE
KQKQKEESPQGSEEKTELKKGSSEESVDEDRGLAPEPLPTAKATSPLIEETPIGSIKDKV
KALQKRVEDEQKGRSKLPVRVKGKEDVPKKTTPRTHPVVSPSSKSSPSSKMERHSSLTSS
AKTERHSPVSPSSKNEKHSPVSPSAKAERHSPVFSGKPEKHSPGSPSTKNERHSPVSSIK
TERHTPVSPSGKTDKRPPVPSSGRTEKHPPVSPGKTEKRSPGAPSIRTPEKQAPGSATGK
HEKHLPVSPGKTEKQPPISPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAK
QKQSQDKSKSRVEKEKGHSVTQRETQRIENQTAKRGQRFQVTGAMESRRFRSTTITVGLR
TEDPVRERFERTPVIKTPEAVPPVAAAVAAAAAEESHRGAETLQEKTVDEQEDMDLQISP
DRKTSTDFSDVIKQELEDNDKYQQFRLTENTEKAQIHLDQVITSPFNTTFPLDYMKDEFL
PALSLQSGALGGSSESLKQEVIAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLS
FSPKKSKEQIGEAKETIKVETPTDIHSEKELPITNDIADSSEKQGAGVPGDSEHVLKEVT
QVPPKDVCSKQEDCPGSHSVSLANETCQALTEEGSCRDSQLPLVSSACKTQAVSETQESL
ATSEVTKAFPPSDATVKTVEGTEPKPQGVIRSPQGLELPLHNRDSEVLSPMADESLAVSH
KDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGILPSHFPLPAAI
AKTDLVAEVASMRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
PSDSSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKTFDELEQEAKQKRDYKR
EPRQDESSSSSDPDADCSAEVDEQKQMGSTEGESDVPVLVTSESRKASSSSESEPELTQL
SKGADSGLLTEPVIRVQPPSPLPSSIDSNSSPEEAQFQPIVPKQYTFKMNEEVKEDPGNP
EEDKDCKSHLAEDSQTHSADGADGSHADLNRETPQLEACDGHGCKAVSPSNSATPVSLGV
QSPECHDVDKPLAIDNDSLALQDTHGSDLEEREFDPSRVESTQASLPSEHSSLSSSSHCA
VPEENESAKEISSPSSPVKVEVTVTDPVLESMSEDCPTQEASTTTHTERFAMDGPVSDIA
ETDENSHPQITSPYENVASSSFFSGEPSNFQTDTCHPTVVHSPEVYSVIIRSSPEDVIMT
SSSSRTDSGEASNCEGHDLDTECEQKSALWPMQSDEPPLSVAPTTPNAPVVTGEQVSKVI
ITKTDVDADSWSEIREDDAAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTP
TSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESLHFFQIGQDSNEETISEDLKEGATGA
EPPQTETTSESLELSGPKEAMDDEGELVPDDVSEEIEDLPASDADLDSKVVISASTETPT
KEAVSTVAEEPATMQWSDSLSTVKQTSCPTFPEPVGQLDFSTVTRSVYSDRDDESPDSSP
EEQKSVIEIPTAPMENVPSAEIKPQIPIRTLPTSVSAPPSAEDESAFSDDFPSGLDGESE
EDGAKPKSKIPIKAPPQRTEWHPSHPDISLQKSGVPQGQDVLSRGPDGRSKSESDASSLD
AKTKCPVKARSYIETETESRERAEGFESESEEGATKPKLFASRLPVKSRSTSSSSRTGTS
PTRESREHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEPPSDDESSSALEVSVIEN
LPPVDTEHSAPEDIFDTRPIWDESIETMIERIPDENGHDRAEDPQDEQERMEERLAYIAD
HLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTVLIECLT
KINRMDIVHLLETNTEPLQERMGRTYAEMEQTITLDHSEGFSVLPEELCAVKEKKEQEAS
KESESSDHPPMVSEEDISVGYSTFQDCIPKTEGDSPAAALSPQMHQESVQQDFSGKMQDQ
QEYYVTTPGAEVEDTQKATVIPDSLCKTPEDISTPPEEAKPCLQTPVAIEHASPIVQEPE
EASEPKEESSPRKTSLVIVESTDDQPQVFEKLDGDAAFQKGDDMPDIPPETVTEEEYVDE
NGHTVVKKVTRKIIRRYVSSDGTEKEEITMQGMPQEPVNIEDGDSYSKVIKRVVLKSDTQ
LSE
Download sequence
Identical sequences ENSRNOP00000052477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]