SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052694 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052694
Domain Number 1 Region: 1339-1570
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000432
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number 2 Region: 1089-1278
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000621
Family Tropomyosin 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000052694
Domain Number - Region: 1582-1830
Classification Level Classification E-value
Superfamily Tropomyosin 0.000111
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number - Region: 560-679
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0131
Family Myosin rod fragments 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052694   Gene: ENSRNOG00000008334   Transcript: ENSRNOT00000055839
Sequence length 1846
Comment pep:known chromosome:Rnor_5.0:5:163253158:163286544:-1 gene:ENSRNOG00000008334 transcript:ENSRNOT00000055839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLSLQEENQLLQQELSRVEDLLAQSRAERDELAIKYNAINERDTEHSQDLDRALLRL
EEEQQRSASLAQVNDMLREQLDQANLANQTLSEDICKVTSDWTRSCKELEQREATWRREE
ESFNAYFSSEHSRLLLLWRQVMGLRRMASEVKMGTERDLLQLGGELVRTSRAVQEVGLGL
SASLQRAESRAEAALEKQKLLQAQLEEQLRAKLLREKDLAQLQVQSDLDKADLSARVTEL
ALSVEHLQNQNTEKDQVNRTLSDKLEALESLRLQEQTTLDTEDGEGLQQTLRDLAQAALS
DTESGVQLSNSERTADTSDGSFRGLFGQRTPTPPRHSSPGRGRSPRRGLSPACSDSSTLT
LIHSALHKRQLQVQDMRGRYEASQDLLGSVRKQLSDSEGERRGLEEQLQRLRDQTATSVQ
AQEDAQREAQRLRSANEILSREKGNLSHSLQVAQQQAEDLRQELEKLQAAQEELRRQHTQ
LEDQQEDTVQEGARARRELERSHRQLEQLEVKRSGLTKELVEVREALSCAVLQRDVLQTE
KAEVAEALTKAEAGRAQLELSVTKLRAEEASLRDSLSKMSALNESLAQDKLELNRLIAQL
EEEKAALLGRQQQAEHATSLAVEKQERLEQLRLEQEVERQGLEGSLCVAEQAREALGQQI
LVLRSERSHLQEQVAQLSRQLNGRDQELDQALRESQRQVEALERAAREKEAMAKERAGLA
VQLAAAEREGRTLSEETIRLRLEKEALESSLFDVQRQLAQLEARREQLEADSQALLLAKE
TLTGELAGLRQQVTATEEKAALDKELMTQKLVQAERETQASLREQRAAHEEDLQRLQREK
EAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSEEIAALQQERDEGLLLAESEKQQ
ALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQSRQEQDRNTVNALTSELRDLRA
QLEEATAAHAQQVKELQEQTGNLGRQREACMREAEELRTQLRLLEDTRDGLRRELLEAQR
KVRDSQDSSEAHRQEASELRRSLSEGTKEREALRRSNEELRTAVKKAESERISLKLANED
KEQKLALLEEARMSVAKEAGELRASLQEVERSRLEARRELQELRRQMKTLDSDNGRLGRE
LADLQSRLALGERTEKESRREVLGLRQKVLKGESSLEALKQELQGSQRKLQEQEAEFRAR
ERGLLGSLEEARGAEKKLLDSARSLELRLEGVRAETSELGLRLSAAEGRAQGLEVELARV
EAQRRVAEAQLGGLRSALRRGLGLGRVSSSPAREAPAGGSGDGLSSPSPLEYSPRSQPPS
PGPVASPAPPDLDPEAVRDALRDFLQELRSAQRERDELRVQTSTLSQQLAEMEAERDHAA
SRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESVRRSRRECRATLDQMAVLERSLQ
ATESELRASQEKVNKMKATEVKLESDKRRLKEVLDASESRSIKLELQRRALEGELQRSRL
GLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLTVERLSGALAKVEESEGTLRSKVQS
LTDALAQSSASLTSSQDKNLYLQKALSTCEHDRQVLQERLDAARQALSEARRQSSSLGEQ
VQTLRGELANLELQRGDAEGQLQQLQQVLRQRQEGEAVALRSVQKLQEERRLLQERLGSL
QRALAQLEAEKRELERSALQLDKDRVALRKTLDKVEREKLRSHEDTLRLNAERGRLDRTL
TGAELDLAEAQQQIQHLEAQVVEVLERNHSPVQVEADEQHLELQQEVERLRSAQVRTERT
LEARERAHRQRVSGLEEQVSTLKAQLHQERHRSSASMSPPSGTPEK
Download sequence
Identical sequences D4AD05
NP_001101460.2.100692 NP_001101460.2.4139 ENSRNOP00000052694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]