SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056945 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056945
Domain Number 1 Region: 203-234
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000262
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 2 Region: 64-88
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000392
Family CCCH zinc finger 0.0047
Further Details:      
 
Domain Number 3 Region: 146-173
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000615
Family CCCH zinc finger 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000056945
Domain Number - Region: 39-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00314
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056945   Gene: ENSRNOG00000027744   Transcript: ENSRNOT00000029618
Sequence length 243
Comment pep:novel chromosome:Rnor_5.0:X:17496972:17498409:1 gene:ENSRNOG00000027744 transcript:ENSRNOT00000029618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVPILAGTIDHNKFALEITMEQQLGAQQLSFPSMDKSGAAVCEFFVKAACGKGGMCPFCH
ISGEKTVVCQHWLRGLCKKGDQCEFLHKYDITKMLECYFYSKFWKCSGKDCSFVHMDPES
KIKDCPWYDCSFCKHGPLCRYQHTRRVLCVNYLVGFCPGGASCKFIHPRFELPMGTIEPS
PLPQQTQPRTKGVPQVIEVMQSQNSSAGTGPWPLEQVSCYKCGEKGHYANRCTKGQLAFL
SGQ
Download sequence
Identical sequences 10116.ENSRNOP00000056945 ENSRNOP00000056945 ENSRNOP00000056945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]