SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061375 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061375
Domain Number 1 Region: 37-228
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.46e-55
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000605
Further Details:      
 
Domain Number 2 Region: 464-654
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.36e-30
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 3 Region: 224-346
Classification Level Classification E-value
Superfamily E set domains 3.73e-26
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000174
Further Details:      
 
Domain Number 4 Region: 724-797
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000157
Family DEATH domain, DD 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061375   Gene: ENSRNOG00000008568   Transcript: ENSRNOT00000011365
Sequence length 847
Comment pep:novel chromosome:Rnor_5.0:3:153324144:153326763:1 gene:ENSRNOG00000008568 transcript:ENSRNOT00000011365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRCYDPGLDGIPEYDDFEFSLSTVEPKDPAPEIAEGPYLVVVEQPKQRGFRFRSDCEGP
SHGGPGASSEKGQKYAIVTIHNYEGPAKIEVDLVTHSDPLHAHAHSLVGKQCSELGMCAV
SVGPKDMTAQFNNLGVLHVTKNNMMEIMIQKLQRQRVRPKPQGLTEAERWELEQEAKELR
EVRELSIVRLSFSAFLRASNGSFSLPLKPLIFKPIHDSKSPGASDLKISRMDKAAGSVRS
GNEVYLLCDKVQKDDIEVHCYETENGWQAFGDFSPTDINKQYSIVFRTPSYHKTKIEQLK
CKHQHRSNVSDSKQFTYYLLVEDKEEVQRKLRTVLPTFSQLFGASHMGGGSGGSARDYGG
AGGGGGLGFFSFTYSPYQSGAAPMGCFPGGEGGAQMAGSGLDRDAGEAAEQTRAPSEAPP
GRAAGPRPAAYKARLFGLALQSSREDARALLAGQRHLLMTQDENGNTPLHLAIHGQNGVL
EQLAYVIYQAQYLGVIKLTNHLHQTLLHLVEITRQTGVVNFLLQVGADPTRARALLQALL
QSGAHALPQMLHMPDFEHLAVHARSPECLDLFIDCGAEVEAAERQGGRTPLHLVTDMEEL
GSVTHLVTKLHAGVDVPTFAGNTPLHLAAGLGSPTLTRLLLKAGTDIHTENEEPCPHPLP
LGSDSDSEEPETDTQRNFRGRTPLDLICSTKVKTLLLTAGQNTTGPPLAPPSPAGPGLSG
DAALQNLEQLLDGPEAQGSWAELAERLRLRSLVDTYRKTPCPSGSLLRSYKLTGGDLVRL
LEALSDMGLQEGVKLLKAPETGDKLPSTEAKEDSANGRQSVEQEADLCPPREPPGGLCHG
RPEPQVH
Download sequence
Identical sequences ENSRNOP00000061375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]